| Product Number |
ARP35871_T100 |
| Product Page |
www.avivasysbio.com/znf225-antibody-n-terminal-region-arp35871-t100.html |
| Name |
ZNF225 Antibody - N-terminal region (ARP35871_T100) |
| Protein Size (# AA) |
706 amino acids |
| Molecular Weight |
82kDa |
| NCBI Gene Id |
7768 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 225 |
| Peptide Sequence |
Synthetic peptide located within the following region: QDDMPCQVDAGLSIIHVKTETSEGRTCKKSFSDVSVLDLHQQLQSREKSH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Shannon,M., et al., Genome Res. 13 (6A), 1097-1110 (2003) |
| Description of Target |
ZNF225 is a candidate transcription factor |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF225 (ARP35871_T100) antibody |
| Blocking Peptide |
For anti-ZNF225 (ARP35871_T100) antibody is Catalog # AAP35871 (Previous Catalog # AAPP07125) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF225 |
| Uniprot ID |
Q9UK10 |
| Protein Name |
Zinc finger protein 225 |
| Protein Accession # |
NP_037494 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_013362 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF225 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF225 Antibody Titration: 0.3125ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
