| Product Number |
ARP35869_P050 |
| Product Page |
www.avivasysbio.com/znf223-antibody-n-terminal-region-arp35869-p050.html |
| Name |
ZNF223 Antibody - N-terminal region (ARP35869_P050) |
| Protein Size (# AA) |
482 amino acids |
| Molecular Weight |
56kDa |
| NCBI Gene Id |
7766 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 223 |
| Peptide Sequence |
Synthetic peptide located within the following region: HEGWSCQQIWEEIASDLTRPQDSTIKSSQFFEQGDAHSQVEEGISIMHTG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Shannon,M., et al., (2003) Genome Res. 13 (6A), 1097-1110 |
| Description of Target |
ZNF223 is part of a ZNF gene cluster located on human chromosome 19q13.2 which encodes Kruppel-associated box (KRAB) motifs. |
| Protein Interactions |
KRTAP10-7; ZC4H2; MDFI; MOK; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF223 (ARP35869_P050) antibody |
| Blocking Peptide |
For anti-ZNF223 (ARP35869_P050) antibody is Catalog # AAP35869 (Previous Catalog # AAPP07123) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF223 |
| Uniprot ID |
Q9UK11 |
| Protein Name |
Zinc finger protein 223 |
| Protein Accession # |
NP_037493 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_013361 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF223 |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF223 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate |
| | Image 2 | Human Skin
 | Human Skin |
|
|
