ZNF175 Antibody - N-terminal region (ARP35832_P050)

Data Sheet
 
Product Number ARP35832_P050
Product Page www.avivasysbio.com/znf175-antibody-n-terminal-region-arp35832-p050.html
Name ZNF175 Antibody - N-terminal region (ARP35832_P050)
Protein Size (# AA) 711 amino acids
Molecular Weight 82kDa
NCBI Gene Id 7728
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 175
Alias Symbols OTK18
Peptide Sequence Synthetic peptide located within the following region: MPADVNLSQKPQVLGPEKQDGSCEASVSFEDVTVDFSREEWQQLDPAQRC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Carlson,K.A., et al., (2004) J. Neuroimmunol. 150 (1-2), 186-198
Description of Target ZNF175 expression in brain mononuclear phagocytes is a signature for advanced HIV-1 encephalitis. As a transcriptional suppressor, this protein plays a role in macrophage control of viral replication during advanced HIV-1 infection.
Protein Interactions KRTAP10-7; ZNF250; ZNF264; PSTPIP1; ALAS1; LPXN; UBC; LZTR1; CDC42;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF175 (ARP35832_P050) antibody
Blocking Peptide For anti-ZNF175 (ARP35832_P050) antibody is Catalog # AAP35832 (Previous Catalog # AAPP07084)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF175
Uniprot ID Q9Y473
Protein Name Zinc finger protein 175
Protein Accession # NP_009078
Purification Affinity Purified
Nucleotide Accession # NM_007147
Tested Species Reactivity Human
Gene Symbol ZNF175
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-ZNF175 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com