Product Number |
ARP35832_P050 |
Product Page |
www.avivasysbio.com/znf175-antibody-n-terminal-region-arp35832-p050.html |
Name |
ZNF175 Antibody - N-terminal region (ARP35832_P050) |
Protein Size (# AA) |
711 amino acids |
Molecular Weight |
82kDa |
NCBI Gene Id |
7728 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 175 |
Alias Symbols |
OTK18 |
Peptide Sequence |
Synthetic peptide located within the following region: MPADVNLSQKPQVLGPEKQDGSCEASVSFEDVTVDFSREEWQQLDPAQRC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Carlson,K.A., et al., (2004) J. Neuroimmunol. 150 (1-2), 186-198 |
Description of Target |
ZNF175 expression in brain mononuclear phagocytes is a signature for advanced HIV-1 encephalitis. As a transcriptional suppressor, this protein plays a role in macrophage control of viral replication during advanced HIV-1 infection. |
Protein Interactions |
KRTAP10-7; ZNF250; ZNF264; PSTPIP1; ALAS1; LPXN; UBC; LZTR1; CDC42; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF175 (ARP35832_P050) antibody |
Blocking Peptide |
For anti-ZNF175 (ARP35832_P050) antibody is Catalog # AAP35832 (Previous Catalog # AAPP07084) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF175 |
Uniprot ID |
Q9Y473 |
Protein Name |
Zinc finger protein 175 |
Protein Accession # |
NP_009078 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_007147 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF175 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF175 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
|