Product Number |
ARP35825_T100 |
Product Page |
www.avivasysbio.com/znf79-antibody-n-terminal-region-arp35825-t100.html |
Name |
ZNF79 Antibody - N-terminal region (ARP35825_T100) |
Protein Size (# AA) |
498 amino acids |
Molecular Weight |
55kDa |
NCBI Gene Id |
7633 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 79 |
Alias Symbols |
pT7 |
Peptide Sequence |
Synthetic peptide located within the following region: PSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSDLEKSFNLRPV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Williams,A.J., (1999) Mol. Cell. Biol. 19 (12), 8526-8535 |
Description of Target |
ZNF79 mapped to 9q34 centromeric to the ABL gene and between a constitutional chromosomal translocation on the centromeric side and the CML specific ABL translocation on the telomeric side. |
Protein Interactions |
KRTAP10-3; TRIM27; MDFI; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF79 (ARP35825_T100) antibody |
Blocking Peptide |
For anti-ZNF79 (ARP35825_T100) antibody is Catalog # AAP35825 (Previous Catalog # AAPP07077) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF79 |
Uniprot ID |
Q15937 |
Protein Name |
Zinc finger protein 79 |
Protein Accession # |
NP_009066 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_007135 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF79 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF79 Antibody Titration: 0.25ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate |
|
|