| Product Number |
ARP35825_P050 |
| Product Page |
www.avivasysbio.com/znf79-antibody-n-terminal-region-arp35825-p050.html |
| Name |
ZNF79 Antibody - N-terminal region (ARP35825_P050) |
| Protein Size (# AA) |
498 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
7633 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 79 |
| Alias Symbols |
pT7 |
| Peptide Sequence |
Synthetic peptide located within the following region: PSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSDLEKSFNLRPV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Huebner,K., et al., (1993) Hum. Genet. 91 (3), 217-222 |
| Description of Target |
ZNF79 mapped to 9q34 centromeric to the ABL gene and between a constitutional chromosomal translocation on the centromeric side and the CML specific ABL translocation on the telomeric side. |
| Protein Interactions |
KRTAP10-3; TRIM27; MDFI; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF79 (ARP35825_P050) antibody |
| Blocking Peptide |
For anti-ZNF79 (ARP35825_P050) antibody is Catalog # AAP35825 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF79 |
| Uniprot ID |
Q15937 |
| Protein Name |
Zinc finger protein 79 |
| Protein Accession # |
NP_009066 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007135 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF79 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF79 Antibody
Titration: 0.25 ug/ml
Positive Control: Jurkat Whole Cell |
|
|
