| Product Number |
ARP35823_T100 |
| Product Page |
www.avivasysbio.com/znf75-antibody-middle-region-arp35823-t100.html |
| Name |
ZNF75 Antibody - middle region (ARP35823_T100) |
| Protein Size (# AA) |
510 amino acids |
| Molecular Weight |
34kDa |
| NCBI Gene Id |
7626 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 75D |
| Alias Symbols |
D8C6, ZNF75, ZNF82, ZSCAN28, ZKSCAN24 |
| Peptide Sequence |
Synthetic peptide located within the following region: LALSEQKRIKHWKMASKLILPESLSLLTFEDVAVYFSEEEWQLLNPLEKT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Villa,A., et al., (1992) Genomics. 13 (4), 1231-6 |
| Description of Target |
The ZNF75 gene, which is located on chromosome X, is predicted to encode a zinc finger protein, currently with unknown fucntion. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF75D (ARP35823_T100) antibody |
| Blocking Peptide |
For anti-ZNF75D (ARP35823_T100) antibody is Catalog # AAP35823 (Previous Catalog # AAPP07075) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF75 |
| Uniprot ID |
P51815 |
| Protein Name |
Zinc finger protein 75D |
| Protein Accession # |
NP_009062 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_007131 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF75D |
| Predicted Species Reactivity |
Human, Dog, Horse |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Horse: 86%; Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF75 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
| | Image 2 | Human kidney
 | Human kidney |
|
|
