ZNF197 Antibody - N-terminal region (ARP35820_P050)

Data Sheet
 
Product Number ARP35820_P050
Product Page www.avivasysbio.com/znf197-antibody-n-terminal-region-arp35820-p050.html
Name ZNF197 Antibody - N-terminal region (ARP35820_P050)
Protein Size (# AA) 267 amino acids
Molecular Weight 30kDa
NCBI Gene Id 10168
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 197
Alias Symbols P18, VHLaK, ZNF20, ZNF166, ZKSCAN9, ZSCAN41, D3S1363E
Peptide Sequence Synthetic peptide located within the following region: MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li,Z., (2003) EMBO J. 22 (8), 1857-1867
Description of Target ZNF197 belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Two alternatively spliced transcripts encoding different isoforms have been described.
Protein Interactions UBC; NDEL1; DISC1; ZNF197; TRIM28; VHL; HIF1A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF197 (ARP35820_P050) antibody
Blocking Peptide For anti-ZNF197 (ARP35820_P050) antibody is Catalog # AAP35820 (Previous Catalog # AAPP07072)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF197
Uniprot ID Q86VG0
Protein Name Zinc finger protein 197
Protein Accession # NP_001020026
Purification Affinity Purified
Nucleotide Accession # NM_001024855
Tested Species Reactivity Human
Gene Symbol ZNF197
Predicted Species Reactivity Human, Rat, Cow, Dog, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 92%; Horse: 100%; Human: 100%; Pig: 100%; Rat: 92%
Image 1
Human Heart
WB Suggested Anti-ZNF197 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com