| Product Number |
ARP35817_P050 |
| Product Page |
www.avivasysbio.com/znf16-antibody-n-terminal-region-arp35817-p050.html |
| Name |
ZNF16 Antibody - N-terminal region (ARP35817_P050) |
| Protein Size (# AA) |
682 amino acids |
| Molecular Weight |
76kDa |
| NCBI Gene Id |
7564 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 16 |
| Alias Symbols |
HZF1, KOX9 |
| Peptide Sequence |
Synthetic peptide located within the following region: PYDMGGQSFQHSVDLTGHEGVPTAESPLICNECGKTFQGNPDLIQRQIVH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Dreier,B., (2000) J. Mol. Biol. 303 (4), 489-502 |
| Description of Target |
ZNF16 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 17 C2H2-type zinc fingers. ZNF16 may be involved in transcriptional regulation.The protein encoded by this gene contains a C2H2 type of zinc finger, and thus may function as a transcription factor. This gene is located in a region close to ZNF7/KOX4, a gene also encoding a zinc finger protein, on chromosome 8. Two alternatively spliced variants, encoding the same protein, have been identified. |
| Protein Interactions |
ZNF101; GORAB; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF16 (ARP35817_P050) antibody |
| Blocking Peptide |
For anti-ZNF16 (ARP35817_P050) antibody is Catalog # AAP35817 (Previous Catalog # AAPP07069) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF16 |
| Uniprot ID |
P17020 |
| Protein Name |
Zinc finger protein 16 |
| Protein Accession # |
NP_001025147 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001029976 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF16 |
| Predicted Species Reactivity |
Human, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 100% |
| Image 1 | Human Muscle
 | WB Suggested Anti-ZNF16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle |
|
|
