HOXC9 Antibody - N-terminal region (ARP35814_T100)

Data Sheet
 
Product Number ARP35814_T100
Product Page www.avivasysbio.com/hoxc9-antibody-n-terminal-region-arp35814-t100.html
Name HOXC9 Antibody - N-terminal region (ARP35814_T100)
Protein Size (# AA) 260 amino acids
Molecular Weight 29kDa
NCBI Gene Id 3225
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Homeobox C9
Alias Symbols HOX3, HOX3B
Peptide Sequence Synthetic peptide located within the following region: MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kosaki,K., (2002) Teratology 65 (2), 50-62
Description of Target HOXC9 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12.
Protein Interactions LPXN; ZNF384; CBX6; GTF2A1L; IRF9; NMI; PCGF2; ZFP36; POU2F1; POLR2D; HOXD9; HOXD1; HOXC13; ELAVL2; POLR3D; GMNN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HOXC9 (ARP35814_T100) antibody
Blocking Peptide For anti-HOXC9 (ARP35814_T100) antibody is Catalog # AAP35814 (Previous Catalog # AAPP07066)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC9
Uniprot ID P31274
Protein Name Homeobox protein Hox-C9
Protein Accession # NP_008828
Purification Protein A purified
Nucleotide Accession # NM_006897
Tested Species Reactivity Human
Gene Symbol HOXC9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Goat: 100%; Human: 100%; Mouse: 100%; Pig: 83%; Rabbit: 100%; Rat: 100%
Image 1
Transfected 293T
WB Suggested Anti-HOXC9 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com