| Product Number |
ARP35795_P050 |
| Product Page |
www.avivasysbio.com/znf230-antibody-n-terminal-region-arp35795-p050.html |
| Name |
ZNF230 Antibody - N-terminal region (ARP35795_P050) |
| Protein Size (# AA) |
474 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
7773 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 230 |
| Alias Symbols |
FDZF2 |
| Peptide Sequence |
Synthetic peptide located within the following region: IHTGQKPSQNGKCKQSFSDVAIFDPPQQFHSGEKSHTCNECGKSFCYISA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Shannon,M., et al., (2003) Genome Res. 13 (6A), 1097-1110 |
| Description of Target |
Located on chromosome 19, ZNF230 is part of a ZNF gene cluster that encodes Kruppel-associated box (KRAB) motifs. |
| Protein Interactions |
KRT40; FSD2; CCDC136; CCNDBP1; MDFI; NDEL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF230 (ARP35795_P050) antibody |
| Blocking Peptide |
For anti-ZNF230 (ARP35795_P050) antibody is Catalog # AAP35795 (Previous Catalog # AAPP07047) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF230 |
| Uniprot ID |
Q9UIE0 |
| Protein Name |
Zinc finger protein 230 |
| Protein Accession # |
NP_006291 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006300 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF230 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF230 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
