| Product Number |
ARP35787_T100 |
| Product Page |
www.avivasysbio.com/chst4-antibody-middle-region-arp35787-t100.html |
| Name |
CHST4 Antibody - middle region (ARP35787_T100) |
| Protein Size (# AA) |
386 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
10164 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4 |
| Description |
|
| Alias Symbols |
GST3, LSST, GlcNAc6ST2, HECGLCNAC6ST |
| Peptide Sequence |
Synthetic peptide located within the following region: CSQQPFEVVEKACRSYSHVVLKEVRFFNLQSLYPLLKDPSLNLHIVHLVR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Akama,T.O., et al., (2002) J. Biol. Chem. 277 (45), 42505-42513 |
| Description of Target |
CHST4 encodes a protein involved in enzymatic synthesis in vitro of the disulfated disaccharide unit of corneal keratan sulfate. |
| Protein Interactions |
DCPS; CD34; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHST4 (ARP35787_T100) antibody |
| Blocking Peptide |
For anti-CHST4 (ARP35787_T100) antibody is Catalog # AAP35787 (Previous Catalog # AAPP07039) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CHST4 |
| Uniprot ID |
Q8NCG5 |
| Protein Name |
Carbohydrate sulfotransferase 4 |
| Publications |
Carbohydrate Sulfotransferase 4 Inhibits the Progression of Hepatitis B Virus-Related Hepatocellular Carcinoma and Is a Potential Prognostic Marker in Several Tumors. Front Oncol. 10, 554331 (2020). 33178582 |
| Protein Accession # |
NP_005760 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_005769 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CHST4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86% |
| Image 1 | Human Lung
 | Human Lung |
|
| Image 2 | Human Jurkat
 | WB Suggested Anti-CHST4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
