Product Number |
ARP35786_P050 |
Product Page |
www.avivasysbio.com/chst4-antibody-middle-region-arp35786-p050.html |
Name |
CHST4 Antibody - middle region (ARP35786_P050) |
Protein Size (# AA) |
386 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
10164 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4 |
Alias Symbols |
GST3, LSST, GlcNAc6ST2, HECGLCNAC6ST |
Peptide Sequence |
Synthetic peptide located within the following region: QKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Akama,T.O., et al., (2002) J. Biol. Chem. 277 (45), 42505-42513 |
Description of Target |
The CHST4 gene encodes a protein that is involved in enzymatic synthesis in vitro of the disulfated disaccharide unit of corneal keratan sulfate. |
Protein Interactions |
DCPS; CD34; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CHST4 (ARP35786_P050) antibody |
Blocking Peptide |
For anti-CHST4 (ARP35786_P050) antibody is Catalog # AAP35786 (Previous Catalog # AAPP07038) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CHST4 |
Uniprot ID |
Q8NCG5 |
Protein Name |
Carbohydrate sulfotransferase 4 |
Protein Accession # |
NP_005760 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005769 |
Tested Species Reactivity |
Human |
Gene Symbol |
CHST4 |
Predicted Species Reactivity |
Human, Cow, Dog, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Horse: 79%; Human: 100%; Rabbit: 79% |
Image 1 | Human HepG2
| WB Suggested Anti-CHST4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|
|