CHST4 Antibody - middle region (ARP35786_P050)

Data Sheet
 
Product Number ARP35786_P050
Product Page www.avivasysbio.com/chst4-antibody-middle-region-arp35786-p050.html
Name CHST4 Antibody - middle region (ARP35786_P050)
Protein Size (# AA) 386 amino acids
Molecular Weight 45kDa
NCBI Gene Id 10164
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4
Alias Symbols GST3, LSST, GlcNAc6ST2, HECGLCNAC6ST
Peptide Sequence Synthetic peptide located within the following region: QKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Akama,T.O., et al., (2002) J. Biol. Chem. 277 (45), 42505-42513
Description of Target The CHST4 gene encodes a protein that is involved in enzymatic synthesis in vitro of the disulfated disaccharide unit of corneal keratan sulfate.
Protein Interactions DCPS; CD34;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CHST4 (ARP35786_P050) antibody
Blocking Peptide For anti-CHST4 (ARP35786_P050) antibody is Catalog # AAP35786 (Previous Catalog # AAPP07038)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CHST4
Uniprot ID Q8NCG5
Protein Name Carbohydrate sulfotransferase 4
Protein Accession # NP_005760
Purification Affinity Purified
Nucleotide Accession # NM_005769
Tested Species Reactivity Human
Gene Symbol CHST4
Predicted Species Reactivity Human, Cow, Dog, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Horse: 79%; Human: 100%; Rabbit: 79%
Image 1
Human HepG2
WB Suggested Anti-CHST4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com