| Product Number |
ARP35777_P050 |
| Product Page |
www.avivasysbio.com/zbtb22-antibody-c-terminal-region-arp35777-p050.html |
| Name |
ZBTB22 Antibody - C-terminal region (ARP35777_P050) |
| Protein Size (# AA) |
634 amino acids |
| Molecular Weight |
66kDa |
| NCBI Gene Id |
9278 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger and BTB domain containing 22 |
| Alias Symbols |
fru, BING1, ZNF297, ZBTB22A, ZNF297A, fruitless |
| Peptide Sequence |
Synthetic peptide located within the following region: MQGNQILVFPSSSSSSSSQAPGQPPGNQAEHGAVTVGGTSVGSLGVPGSV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Herberg,J.A., (1998) J. Mol. Biol. 277 (4), 839-857 |
| Description of Target |
ZBTB22 contains 1 BTB (POZ) domain and 3 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZBTB22 may be involved in transcriptional regulation. |
| Protein Interactions |
MCRS1; RBM39; FXR2; VAPA; PIN1; MLLT6; AP4M1; GATA1; DNAJA3; UBQLN4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZBTB22 (ARP35777_P050) antibody |
| Blocking Peptide |
For anti-ZBTB22 (ARP35777_P050) antibody is Catalog # AAP35777 (Previous Catalog # AAPP07029) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZBTB22 |
| Uniprot ID |
O15209 |
| Protein Name |
Zinc finger and BTB domain-containing protein 22 |
| Protein Accession # |
NP_005444 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005453 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZBTB22 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-ZBTB22 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T |
|
