website statistics
Product Datasheet: ARP35766_T100 - HMGB3 antibody - C-terminal region (ARP35766_T100) - Aviva Systems Biology
HMGB3 antibody - C-terminal region (ARP35766_T100)
Data Sheet
Product Number ARP35766_T100
Product Page
Product Name HMGB3 antibody - C-terminal region (ARP35766_T100)
Size 100 ul
Gene Symbol HMGB3
Alias Symbols HMG4, HMG-4, HMG2A, HMG-2a
Protein Size (# AA) 200 amino acids
Molecular Weight 23kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 3149
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name High mobility group box 3
Description This is a rabbit polyclonal antibody against HMGB3. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: NLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEE
Target Reference Vaccari,T., et al., (1998) Genomics 49 (2), 247-252
Description of Target The human HMG2a gene is transcribed mainly in the placenta. HMG2a encodes a protein which is part of the high mobility group (HMG) family. Members of this family are ubiquitously expressed and facilitate the formation of nucleoprotein complexes where the DNA is sharply bent.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-HMGB3 (ARP35766_T100) antibody is Catalog # AAP35766 (Previous Catalog # AAPP07018)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HMGB3
Complete computational species homology data Anti-HMGB3 (ARP35766_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HMGB3.
Swissprot Id O15347
Protein Name High mobility group protein B3
Protein Accession # NP_005333
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HMGB3.
Nucleotide Accession # NM_005342
Replacement Item This antibody may replace item sc-133660 from Santa Cruz Biotechnology.
Conjugation Options

ARP35766_T100-FITC Conjugated

ARP35766_T100-HRP Conjugated

ARP35766_T100-Biotin Conjugated

CB Replacement sc-133660; sc-33199
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Image 1
Human Intestine
Human Intestine
Image 2
Human Placenta
WB Suggested Anti-HMGB3 Antibody Titration: 0.3ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |