website statistics
Product Datasheet: ARP35764_P050 - DLX6 antibody - middle region (ARP35764_P050) - Aviva Systems Biology
DLX6 antibody - middle region (ARP35764_P050)
Data Sheet
Product Number ARP35764_P050
Product Page
Product Name DLX6 antibody - middle region (ARP35764_P050)
Size 100 ul
Gene Symbol DLX6
Protein Size (# AA) 265 amino acids
Molecular Weight 29kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 1750
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Distal-less homeobox 6
Description This is a rabbit polyclonal antibody against DLX6. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: ENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAAS
Target Reference Charite,J., et al., (2001) Genes Dev. 15 (22), 3039-49
Description of Target The DLX6 gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7.
Protein Interactions HSP90AA1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-DLX6 (ARP35764_P050) antibody is Catalog # AAP35764 (Previous Catalog # AAPP07016)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DLX6
Complete computational species homology data Anti-DLX6 (ARP35764_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DLX6.
Protein Accession # XP_376652
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DLX6.
Nucleotide Accession # XM_376652
Replacement Item This antibody may replace item sc-18154 from Santa Cruz Biotechnology.
Conjugation Options

ARP35764_P050-FITC Conjugated

ARP35764_P050-HRP Conjugated

ARP35764_P050-Biotin Conjugated

CB Replacement sc-18154; sc-18155; sc-517058
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-DLX6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |