Product Number |
ARP35764_P050 |
Product Page |
www.avivasysbio.com/dlx6-antibody-middle-region-arp35764-p050.html |
Name |
DLX6 Antibody - middle region (ARP35764_P050) |
Protein Size (# AA) |
265 amino acids |
Molecular Weight |
29kDa |
NCBI Gene Id |
1750 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Distal-less homeobox 6 |
Peptide Sequence |
Synthetic peptide located within the following region: ENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAAS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Charite,J., et al., (2001) Genes Dev. 15 (22), 3039-49 |
Description of Target |
The DLX6 gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. |
Protein Interactions |
HSP90AA1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DLX6 (ARP35764_P050) antibody |
Blocking Peptide |
For anti-DLX6 (ARP35764_P050) antibody is Catalog # AAP35764 (Previous Catalog # AAPP07016) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DLX6 |
Uniprot ID |
P56179 |
Protein Accession # |
XP_376652 |
Purification |
Affinity Purified |
Nucleotide Accession # |
XM_376652 |
Tested Species Reactivity |
Human |
Gene Symbol |
DLX6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-DLX6 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
|