DLX6 Antibody - middle region (ARP35764_P050)

Data Sheet
 
Product Number ARP35764_P050
Product Page www.avivasysbio.com/dlx6-antibody-middle-region-arp35764-p050.html
Name DLX6 Antibody - middle region (ARP35764_P050)
Protein Size (# AA) 265 amino acids
Molecular Weight 29kDa
NCBI Gene Id 1750
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Distal-less homeobox 6
Peptide Sequence Synthetic peptide located within the following region: ENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAAS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Charite,J., et al., (2001) Genes Dev. 15 (22), 3039-49
Description of Target The DLX6 gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7.
Protein Interactions HSP90AA1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DLX6 (ARP35764_P050) antibody
Blocking Peptide For anti-DLX6 (ARP35764_P050) antibody is Catalog # AAP35764 (Previous Catalog # AAPP07016)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DLX6
Uniprot ID P56179
Protein Accession # XP_376652
Purification Affinity Purified
Nucleotide Accession # XM_376652
Tested Species Reactivity Human
Gene Symbol DLX6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-DLX6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com