| Product Number |
ARP35711_T100 |
| Product Page |
www.avivasysbio.com/sox14-antibody-n-terminal-region-arp35711-t100.html |
| Name |
SOX14 Antibody - N-terminal region (ARP35711_T100) |
| Protein Size (# AA) |
240 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
8403 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
SRY (sex determining region Y)-box 14 |
| Alias Symbols |
SOX28 |
| Peptide Sequence |
Synthetic peptide located within the following region: LRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hargrave,M., et al., (2000) Hum Genet. 106(4), 432-9 |
| Description of Target |
SOX14 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in SOX14 are suggested to be responsible for the limb defects associated with blepharophimosis, ptosis, epicanthus inversus syndrome (BPES) and Mobius syndrome. |
| Protein Interactions |
NAIF1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SOX14 (ARP35711_T100) antibody |
| Blocking Peptide |
For anti-SOX14 (ARP35711_T100) antibody is Catalog # AAP35711 (Previous Catalog # AAPP06957) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SOX14 |
| Uniprot ID |
O95416 |
| Protein Name |
Transcription factor SOX-14 |
| Protein Accession # |
NP_004180 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_004189 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SOX14 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Goat, Guinea Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-SOX14 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
|
