Product Number |
ARP35675_T100 |
Product Page |
www.avivasysbio.com/znf134-antibody-middle-region-arp35675-t100.html |
Name |
ZNF134 Antibody - middle region (ARP35675_T100) |
Protein Size (# AA) |
348 amino acids |
Molecular Weight |
40kDa |
NCBI Gene Id |
7693 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 134 |
Alias Symbols |
pHZ-15 |
Peptide Sequence |
Synthetic peptide located within the following region: SEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Tommerup,N., et al., (1995) Genomics 27 (2), 259-264 |
Description of Target |
ZNF134 is a candidate transcription factor |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF134 (ARP35675_T100) antibody |
Blocking Peptide |
For anti-ZNF134 (ARP35675_T100) antibody is Catalog # AAP35675 (Previous Catalog # AAPP06921) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF134 |
Uniprot ID |
P52741 |
Protein Name |
Zinc finger protein 134 |
Purification |
Protein A purified |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF134 |
Predicted Species Reactivity |
Human, Pig |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 86% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF134 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
| Image 2 | Human kidney
| Human kidney |
|
|