Product Number |
ARP35674_P050 |
Product Page |
www.avivasysbio.com/znf133-antibody-n-terminal-region-arp35674-p050.html |
Name |
ZNF133 Antibody - N-terminal region (ARP35674_P050) |
Protein Size (# AA) |
653 amino acids |
Molecular Weight |
73kDa |
NCBI Gene Id |
7692 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 133 |
Alias Symbols |
ZNF150, pHZ-13, pHZ-66 |
Peptide Sequence |
Synthetic peptide located within the following region: LRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lee,S.J., (2007) Exp. Mol. Med. 39 (4), 450-457 |
Description of Target |
ZNF133 may be involved in transcriptional regulation as a repressor. |
Protein Interactions |
KRTAP10-7; MDM2; FOS; TRIM28; MAPK6; PDPK1; ILK; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF133 (ARP35674_P050) antibody |
Blocking Peptide |
For anti-ZNF133 (ARP35674_P050) antibody is Catalog # AAP35674 (Previous Catalog # AAPP06920) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF133 |
Uniprot ID |
Q53XU1 |
Protein Name |
Zinc finger protein 133 |
Sample Type Confirmation |
ZNF133 is strongly supported by BioGPS gene expression data to be expressed in 721_B |
Protein Accession # |
NP_003425 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003434 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
ZNF133 |
Predicted Species Reactivity |
Human, Mouse, Horse, Pig, Rabbit |
Application |
IF, WB |
Predicted Homology Based on Immunogen Sequence |
Horse: 92%; Human: 100%; Mouse: 83%; Pig: 100%; Rabbit: 93% |
Image 1 | Human 721_B
| WB Suggested Anti-ZNF133 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: 721_B cell lysateZNF133 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells |
| Image 2 | Mouse
| WB Suggested Anti-DPYS (dihydropyrimidinase) Antibody (Clone #:8B11)(100ug) Titration: 0.5 ug/ml Positive Control: Fetal Liver |
|
|