ZNF133 Antibody - N-terminal region (ARP35674_P050)

Data Sheet
 
Product Number ARP35674_P050
Product Page www.avivasysbio.com/znf133-antibody-n-terminal-region-arp35674-p050.html
Name ZNF133 Antibody - N-terminal region (ARP35674_P050)
Protein Size (# AA) 653 amino acids
Molecular Weight 73kDa
NCBI Gene Id 7692
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 133
Alias Symbols ZNF150, pHZ-13, pHZ-66
Peptide Sequence Synthetic peptide located within the following region: LRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lee,S.J., (2007) Exp. Mol. Med. 39 (4), 450-457
Description of Target ZNF133 may be involved in transcriptional regulation as a repressor.
Protein Interactions KRTAP10-7; MDM2; FOS; TRIM28; MAPK6; PDPK1; ILK;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF133 (ARP35674_P050) antibody
Blocking Peptide For anti-ZNF133 (ARP35674_P050) antibody is Catalog # AAP35674 (Previous Catalog # AAPP06920)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF133
Uniprot ID Q53XU1
Protein Name Zinc finger protein 133
Sample Type Confirmation

ZNF133 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_003425
Purification Affinity Purified
Nucleotide Accession # NM_003434
Tested Species Reactivity Human, Mouse
Gene Symbol ZNF133
Predicted Species Reactivity Human, Mouse, Horse, Pig, Rabbit
Application IF, WB
Predicted Homology Based on Immunogen Sequence Horse: 92%; Human: 100%; Mouse: 83%; Pig: 100%; Rabbit: 93%
Image 1
Human 721_B
WB Suggested Anti-ZNF133 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysateZNF133 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Image 2
Mouse
WB Suggested Anti-DPYS (dihydropyrimidinase) Antibody (Clone #:8B11)(100ug)
Titration: 0.5 ug/ml
Positive Control: Fetal Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com