ZNF84 Antibody - C-terminal region (ARP35668_T100)

• Product Number: ARP35668_T100
• Name: ZNF84 Antibody - C-terminal region (ARP35668_T100)
• Protein Size (# AA): 738 amino acids
• Molecular Weight: 85kDa
• NCBI Gene Id: 7637
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 84
• Alias Symbols: HPF2
• Peptide Sequence: Synthetic peptide located within the following region: RKAFSQKSQLVNHQRIHTGEKPYRCIECGKAFSQKSQLINHQRTHTVKKS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Rosati,M., et al., (2001) Cytogenet. Cell Genet. 94 (3-4), 127-130
• Description of Target: ZNF84, a gene located on chromosome 12, encodes a zinc finger protein whose function is undescribed.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF84 (ARP35668_T100) antibody is Catalog # AAP35668 (Previous Catalog # AAPP06914)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF84
• Uniprot ID: P51523
• Protein Name: Zinc finger protein 84
• Protein Accession #: NP_003419
• Purification: Protein A purified
• Nucleotide Accession #: NM_003428
• Tested Species Reactivity: Human
• Gene Symbol: ZNF84
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 90%; Rabbit: 100%; Rat: 83%
• Image 1: Human kidney
  
  Human kidney
• Image 2: Human heart
  
  WB Suggested Anti-ZNF84 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human heart