SLC18A1 Antibody - N-terminal region (ARP35650_P050)

• Product Number: ARP35650_P050
• Name: SLC18A1 Antibody - N-terminal region (ARP35650_P050)
• Protein Size (# AA): 525 amino acids
• Molecular Weight: 56 kDa
• NCBI Gene Id: 6570
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 18 (vesicular monoamine), member 1
• Alias Symbols: CGAT, VAT1, VMAT1
• Peptide Sequence: Synthetic peptide located within the following region: MNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Horvath,G., et al., (2003) Am. J. Physiol. Lung Cell Mol. Physiol. 285 (4), L829-L837
• Description of Target: SLC18A1 is an integral protein in the membrane of secretory vesicles of neuroendocrine and endocrine cells that allows the transport of biogenic monoamines, such as serotonin, from the cytoplasm into the secretory vesicles.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC18A1 (ARP35650_P050) antibody is Catalog # AAP35650 (Previous Catalog # AAPP08007)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC18A1
• Uniprot ID: P54219
• Protein Name: Chromaffin granule amine transporter
• Protein Accession #: NP_003044
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003053
• Tested Species Reactivity: Human
• Gene Symbol: SLC18A1
• Predicted Species Reactivity: Human, Guinea Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 79%; Human: 100%
• Image 1:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.