HOXB2 Antibody - N-terminal region (ARP35647_P050)

• Product Number: ARP35647_P050
• Name: HOXB2 Antibody - N-terminal region (ARP35647_P050)
• Protein Size (# AA): 356 amino acids
• Molecular Weight: 38kDa
• NCBI Gene Id: 3212
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Homeobox B2
• Alias Symbols: K8, HOX2, HOX2H, Hox-2.8
• Peptide Sequence: Synthetic peptide located within the following region: RAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Inamura,K., (2007) J Thorac Oncol 2 (9), 802-807
• Description of Target: HOXB2 is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. HOXB2 functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with pancreatic cancer.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with pancreatic cancer. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: CREBBP; MNDA; EP300; SOD1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HOXB2 (ARP35647_P050) antibody is Catalog # AAP35647 (Previous Catalog # AAPP07894)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB2
• Uniprot ID: P14652
• Protein Name: Homeobox protein Hox-B2
• Protein Accession #: NP_002136
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002145
• Tested Species Reactivity: Human
• Gene Symbol: HOXB2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 79%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-HOXB2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate
• Image 2: Human Hela
  
  Host: Rabbit
  Target Name: HOXB2
  Sample Type: Hela
  Antibody Dilution: 1.0ug/ml
• Image 3: Human 721_B
  
  Host: Rabbit
  Target Name: HOXB2
  Sample Type: 721_B
  Antibody Dilution: 1.0ug/ml
• Image 4: Human MCF7
  
  Host: Rabbit
  Target Name: HOXB2
  Sample Type: MCF7
  Antibody Dilution: 1.0ug/ml
• Image 5: Human Jurkat
  
  Host: Rabbit
  Target Name: HOXB2
  Sample Type: Jurkat
  Antibody Dilution: 1.0ug/ml
• Image 6: Human HepG2
  
  Host: Rabbit
  Target Name: HOXB2
  Sample Type: HepG2
  Antibody Dilution: 1.0ug/ml