KLF6 Antibody - middle region (ARP35639_P050)

• Product Number: ARP35639_P050
• Name: KLF6 Antibody - middle region (ARP35639_P050)
• Protein Size (# AA): 283 amino acids
• Molecular Weight: 32kDa
• NCBI Gene Id: 1316
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Kruppel-like factor 6
• Alias Symbols: GBF, ZF9, BCD1, CBA1, CPBP, PAC1, ST12, COPEB
• Peptide Sequence: Synthetic peptide located within the following region: SREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Chiambaretta,F., (2006) Invest. Ophthalmol. Vis. Sci. 47 (2), 582-590
• Description of Target: KLF6 is a nuclear protein that has three zinc fingers at the end of its C-terminal domain, a serine/threonine-rich central region, and an acidic domain lying within the N-terminal region. The zinc fingers of this protein are responsible for the specific DNA binding with the guanine-rich core promoter elements. The central region might be involved in activation or posttranslational regulatory pathways, and the acidic N-terminal domain might play an important role in the process of transcriptional activation. It is capable of activating transcription approximately 4-fold either on homologous or heterologous promoters. KLF6 may participate in the regulation and/or maintenance of the basal expression of pregnancy-specific glycoprotein genes and possibly other TATA box-less genes.This gene encodes a nuclear protein that has three zinc fingers at the end of its C-terminal domain, a serine/threonine-rich central region, and an acidic domain lying within the N-terminal region. The zinc fingers of this protein are responsible for the specific DNA binding with the guanine-rich core promoter elements. The central region might be involved in activation or posttranslational regulatory pathways, and the acidic N-terminal domain might play an important role in the process of transcriptional activation. It is capable of activating transcription approximately 4-fold either on homologous or heterologous promoters. The DNA binding and transcriptional activity of this protein, in conjunction with its expression pattern, suggests that this protein may participate in the regulation and/or maintenance of the basal expression of pregnancy-specific glycoprotein genes and possibly other TATA box-less genes. Two transcript variants encoding the same protein have been found for this gene.
• Protein Interactions: UBC; APP; LCOR; SP1; NUFIP1; NOP56; TAF9; FBL; HDAC3; E2F1; NR0B2; PNO1; POLA2; GTF3C1; EHMT2; APOM; CELSR2; KLF4; TP53; CCND1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KLF6 (ARP35639_P050) antibody is Catalog # AAP35639 (Previous Catalog # AAPP07886)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLF6
• Uniprot ID: Q99612
• Protein Name: Krueppel-like factor 6
• Protein Accession #: NP_001291
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001300
• Tested Species Reactivity: Human
• Gene Symbol: KLF6
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 86%
• Image 1: Transfected 293T
  
  WB Suggested Anti-KLF6 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Transfected 293T