CACNB2 Antibody - middle region (ARP35590_T100)

• Product Number: ARP35590_T100
• Name: CACNB2 Antibody - middle region (ARP35590_T100)
• Protein Size (# AA): 605 amino acids
• Molecular Weight: 67kDa
• Subunit: beta-2
• NCBI Gene Id: 783
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Calcium channel, voltage-dependent, beta 2 subunit
• Alias Symbols: CAB2, MYSB, CAVB2, CACNLB2
• Peptide Sequence: Synthetic peptide located within the following region: ACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Harry,J.B., (2004) J. Biol. Chem. 279 (45), 46367-46372
• Description of Target: CACNB2 is a subunit of voltage-dependent calcium (Ca2+) channels, expressed in the CNS. It appears to serve an obligatory function.
• Protein Interactions: REM1; PRKACA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CACNB2 (ARP35590_T100) antibody is Catalog # AAP35590 (Previous Catalog # AAPP23771)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CACNB2
• Uniprot ID: Q5VWD7
• Protein Accession #: NP_000715
• Purification: Protein A purified
• Nucleotide Accession #: NM_000724
• Tested Species Reactivity: Human
• Gene Symbol: CACNB2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Zebrafish: 82%
• Image 1: Human HepG2
  
  WB Suggested Anti-CACNB2 Antibody Titration: 2.5ug/ml
  Positive Control: HepG2 cell lysate