| Product Number |
ARP35574_T100 |
| Product Page |
www.avivasysbio.com/gabrg2-antibody-c-terminal-region-arp35574-t100.html |
| Name |
GABRG2 Antibody - C-terminal region (ARP35574_T100) |
| Protein Size (# AA) |
327 amino acids |
| Molecular Weight |
36kDa |
| Subunit |
gamma-2 |
| NCBI Gene Id |
2566 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, gamma 2 |
| Alias Symbols |
CAE2, ECA2, FEB8, DEE74, EIEE74, GEFSP3 |
| Peptide Sequence |
Synthetic peptide located within the following region: AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Sancar,F. (2004) J. Biol. Chem. 279 (45), 47034-47039 |
| Description of Target |
Gamma-aminobutyric acid (GABA), the major inhibitory neurotransmitter in the brain, mediates neuronal inhibition by binding to GABA receptors. The type A GABA receptors are pentameric chloride channels assembled from among many genetic variants of GABA(A) subunits. GABRG2 is the gamma 2 subunit of GABA(A) receptor. Mutations in this gene have been associated with epilepsy and febrile seizures.Gamma-aminobutyric acid (GABA), the major inhibitory neurotransmitter in the brain, mediates neuronal inhibition by binding to GABA receptors. The type A GABA receptors are pentameric chloride channels assembled from among many genetic variants of GABA(A) subunits. This gene encodes the gamma 2 subunit of GABA(A) receptor. Mutations in this gene have been associated with epilepsy and febrile seizures. Alternative splicing of this gene results in transcript variants encoding different isoforms. |
| Protein Interactions |
ZDHHC3; GABARAP; PRKCB; PRKCA; GABRG2; DRD5; PPP3CA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GABRG2 (ARP35574_T100) antibody |
| Blocking Peptide |
For anti-GABRG2 (ARP35574_T100) antibody is Catalog # AAP35574 (Previous Catalog # AAPP23762) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GABRG2 |
| Uniprot ID |
P18507 |
| Protein Name |
Gamma-aminobutyric acid receptor subunit gamma-2 |
| Protein Accession # |
NP_944493 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_198903 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GABRG2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-GABRG2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
