SCN5A Antibody - C-terminal region (ARP35542_P050)

• Product Number: ARP35542_P050
• Name: SCN5A Antibody - C-terminal region (ARP35542_P050)
• Protein Size (# AA): 2015 amino acids
• Molecular Weight: 222kDa
• Subunit: alpha
• NCBI Gene Id: 6331
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Sodium channel, voltage-gated, type V, alpha subunit
• Alias Symbols: HB1, HB2, HH1, IVF, VF1, HBBD, ICCD, LQT3, SSS1, CDCD2, CMD1E, CMPD2, PFHB1, Nav1.5
• Peptide Sequence: Synthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Shah,V.N., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (10), 3592-3597
• Description of Target: SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram.The protein encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The encoded protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. Defects in this gene are a cause of long QT syndrome type 3 (LQT3), an autosomal dominant cardiac disease. Alternative splicing results in two transcript variants encoding separate isoforms which differ by a single amino acid. Mutation nomenclature has been assigned with respect to the longer isoform.
• Protein Interactions: CALM1; CAV3; ALB; Nedd4; WWP2; UBC; SNTG2; NEDD4L; DLG2; INADL; DLG4; RGS3; SNTA1; DLG1; RGS2; SCN5A; SNTB2; SNTB1; DLG3; CBL;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SCN5A (ARP35542_P050) antibody is Catalog # AAP35542 (Previous Catalog # AAPP06782)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SCN5A
• Uniprot ID: Q8IZC9
• Protein Name: Sodium channel protein type 5 subunit alpha
• Publications:

  Askar, S. F. A. et al. Similar arrhythmicity in hypertrophic and fibrotic cardiac cultures caused by distinct substrate-specific mechanisms. Cardiovasc. Res. 97, 171-81 (2013). 22977008

  Colussi, C. et al. The histone deacetylase inhibitor suberoylanilide hydroxamic acid reduces cardiac arrhythmias in dystrophic mice. Cardiovasc. Res. 87, 73-82 (2010). 20164117

  Costa, A. R. et al. Optical mapping of cryoinjured rat myocardium grafted with mesenchymal stem cells. Am. J. Physiol. Heart Circ. Physiol. 302, H270-7 (2012). 22037193

  House, C. D. et al. Voltage-gated Na+ channel SCN5A is a key regulator of a gene transcriptional network that controls colon cancer invasion. Cancer Res. 70, 6957-67 (2010). 20651255

• Sample Type Confirmation:

  SCN5A is supported by BioGPS gene expression data to be expressed in SW620

• Protein Accession #: NP_000326
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000335
• Tested Species Reactivity: Human
• Gene Symbol: SCN5A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human A172 Whole Cell
  
  Host: Rabbit
  Target Name: SCN5A
  Sample Tissue: Human A172 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 2: MCF7 Whole Cell
  
  Host: Rabbit
  Target Name: SCN5A
  Sample Type: MCF7 Whole Cell
  Lane A: Primary Antibody
  Lane B: Primary Antibody + Blocking Peptide
  Primary Antibody Concentration: 1ug/ml
  Peptide Concentration: 5ug/ml
  Lysate Quantity: 25ug/lane/Lane
  Gel Concentration: 0.12
• Image 3: Human SW620
  
  WB Suggested Anti-SCN5A Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: SW620 cell lysateSCN5A is supported by BioGPS gene expression data to be expressed in SW620