Product Number |
ARP35538_P050 |
Product Page |
www.avivasysbio.com/nudt9-antibody-c-terminal-region-arp35538-p050.html |
Name |
NUDT9 Antibody - C-terminal region (ARP35538_P050) |
Protein Size (# AA) |
300 amino acids |
Molecular Weight |
33kDa |
NCBI Gene Id |
53343 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Nudix (nucleoside diphosphate linked moiety X)-type motif 9 |
Alias Symbols |
NUDT10 |
Peptide Sequence |
Synthetic peptide located within the following region: LEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270 |
Description of Target |
Human ADP-ribose pyrophosphatase NUDT9 belongs to a superfamily of Nudix hydrolases that catabolize potentially toxic compounds in the cell. NUDT9 alpha protein is targeted highly specifically to mitochondria, whereas the predicted protein of the NUDT9 beta transcript, which is missing this sequence, exhibits no clear subcellular localization. Investigation of the physical and enzymatic properties of NUDT9 indicates that it is functional as a monomer, optimally active at near neutral pH, and that it requires divalent metal ions and an intact Nudix motif for enzymatic activity. |
Protein Interactions |
EPHA2; APP; GLOD4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NUDT9 (ARP35538_P050) antibody |
Blocking Peptide |
For anti-NUDT9 (ARP35538_P050) antibody is Catalog # AAP35538 (Previous Catalog # AAPP06778) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NUDT9 |
Uniprot ID |
Q8NG26 |
Protein Name |
Putative nudix hydrolyase EMBL AAM46066.1 |
Protein Accession # |
NP_932155 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_198038 |
Tested Species Reactivity |
Human |
Gene Symbol |
NUDT9 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 77% |
Image 1 | Human Skin
| Human Skin |
| Image 2 | Human Jurkat
| WB Suggested Anti-NUDT9 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
|