NUDT9 Antibody - C-terminal region (ARP35538_P050)

Data Sheet
 
Product Number ARP35538_P050
Product Page www.avivasysbio.com/nudt9-antibody-c-terminal-region-arp35538-p050.html
Name NUDT9 Antibody - C-terminal region (ARP35538_P050)
Protein Size (# AA) 300 amino acids
Molecular Weight 33kDa
NCBI Gene Id 53343
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nudix (nucleoside diphosphate linked moiety X)-type motif 9
Alias Symbols NUDT10
Peptide Sequence Synthetic peptide located within the following region: LEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270
Description of Target Human ADP-ribose pyrophosphatase NUDT9 belongs to a superfamily of Nudix hydrolases that catabolize potentially toxic compounds in the cell. NUDT9 alpha protein is targeted highly specifically to mitochondria, whereas the predicted protein of the NUDT9 beta transcript, which is missing this sequence, exhibits no clear subcellular localization. Investigation of the physical and enzymatic properties of NUDT9 indicates that it is functional as a monomer, optimally active at near neutral pH, and that it requires divalent metal ions and an intact Nudix motif for enzymatic activity.
Protein Interactions EPHA2; APP; GLOD4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NUDT9 (ARP35538_P050) antibody
Blocking Peptide For anti-NUDT9 (ARP35538_P050) antibody is Catalog # AAP35538 (Previous Catalog # AAPP06778)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NUDT9
Uniprot ID Q8NG26
Protein Name Putative nudix hydrolyase EMBL AAM46066.1
Protein Accession # NP_932155
Purification Affinity Purified
Nucleotide Accession # NM_198038
Tested Species Reactivity Human
Gene Symbol NUDT9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 77%
Image 1
Human Skin
Human Skin
Image 2
Human Jurkat
WB Suggested Anti-NUDT9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com