Product Number |
ARP35529_T100 |
Product Page |
www.avivasysbio.com/kcnq1-antibody-n-terminal-region-arp35529-t100.html |
Name |
KCNQ1 Antibody - N-terminal region (ARP35529_T100) |
Protein Size (# AA) |
549 amino acids |
Molecular Weight |
60kDa |
NCBI Gene Id |
3784 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Potassium voltage-gated channel, KQT-like subfamily, member 1 |
Alias Symbols |
LQT, RWS, WRS, LQT1, SQT2, ATFB1, ATFB3, JLNS1, KCNA8, KCNA9, Kv1.9, Kv7.1, KVLQT1 |
Peptide Sequence |
Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Du,LP., et al., (2005) Biochem Biophys Res Commun. 332(3), 677-87 |
Description of Target |
KCNQ1 encodes a protein for a voltage-gated potassium channel required for the repolarization phase of the cardiac action potential. The gene product can form heteromultimers with two other potassium channel proteins, KCNE1 and KCNE3. Mutations in KCNQ1 are associated with hereditary long QT syndrome, Romano-Ward syndrome, Jervell and Lange-Nielsen syndrome and familial atrial fibrillation. |
Protein Interactions |
ATP4A; NEDD4L; AP2M1; USP2; UBC; NEDD4; PRKACA; KCNE1; HSPA4; KCNE4; AKAP9; KCNE2; TRAF6; KCNQ2; PRKAR2A; PPP1CA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KCNQ1 (ARP35529_T100) antibody |
Blocking Peptide |
For anti-KCNQ1 (ARP35529_T100) antibody is Catalog # AAP35529 (Previous Catalog # AAPP06769) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNQ1 |
Uniprot ID |
P51787-2 |
Protein Name |
Potassium voltage-gated channel subfamily KQT member 1 |
Protein Accession # |
NP_861463 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_181798 |
Tested Species Reactivity |
Human, Mouse, Hamster |
Gene Symbol |
KCNQ1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-KCNQ1 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
Image 2 | Hamster
| Lanes: 100 ug CHO cell lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Goat anti-rabbit HRP Secondary Antibody Dilution: 1:25000 Gene Name: KCNQ1 Submitted by: Anonymous
|
|
Image 3 | Mouse Brain
| Host: Mouse Target Name: KCNQ1 Sample Tissue: Mouse Brain Antibody Dilution: 1ug/ml |
|