P2RX2 Antibody - N-terminal region (ARP35508_P050)

• Product Number: ARP35508_P050
• Name: P2RX2 Antibody - N-terminal region (ARP35508_P050)
• Protein Size (# AA): 404 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 22953
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Purinergic receptor P2X, ligand-gated ion channel, 2
• Alias Symbols: P2X2, DFNA41
• Peptide Sequence: Synthetic peptide located within the following region: VVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Aschrafi,A., et al., (2004) J. Mol. Biol. 342 (1), 333-343
• Description of Target: The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle.
• Protein Interactions: P2RX2; GABRR1; P2RX3; P2RX1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-P2RX2 (ARP35508_P050) antibody is Catalog # AAP35508 (Previous Catalog # AAPP06748)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human P2RX2
• Uniprot ID: Q9UBL9-2
• Protein Name: P2X purinoceptor 2
• Protein Accession #: NP_777362
• Purification: Affinity Purified
• Nucleotide Accession #: NM_174873
• Tested Species Reactivity: Human
• Gene Symbol: P2RX2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 79%
• Image 1: Human Jurkat
  
  WB Suggested Anti-P2RX2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysate