Product Number |
ARP35504_T100 |
Product Page |
www.avivasysbio.com/clcn3-antibody-c-terminal-region-arp35504-t100.html |
Name |
CLCN3 Antibody - C-terminal region (ARP35504_T100) |
Protein Size (# AA) |
866 amino acids |
Molecular Weight |
95kDa |
NCBI Gene Id |
1182 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Chloride channel, voltage-sensitive 3 |
Alias Symbols |
CLC3, ClC-3 |
Peptide Sequence |
Synthetic peptide located within the following region: VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Salazar,G., et al., (2004) J. Biol. Chem. 279 (24), 25430-25439 |
Description of Target |
CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator). |
Protein Interactions |
GOPC; SLC9A3R1; PDZK1; CLCN3; CFTR; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CLCN3 (ARP35504_T100) antibody |
Blocking Peptide |
For anti-CLCN3 (ARP35504_T100) antibody is Catalog # AAP35504 (Previous Catalog # AAPP06744) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human CLCN3 |
Uniprot ID |
P51790 |
Protein Name |
H(+)/Cl(-) exchange transporter 3 |
Publications |
Jensen, V. K. et al. A quantitative assay for lysosomal acidification rates in human osteoclasts. Assay Drug Dev. Technol. 9, 157-64 (2011). 21050068 |
Protein Accession # |
NP_776297 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_173872 |
Tested Species Reactivity |
Human |
Gene Symbol |
CLCN3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 91%; Zebrafish: 100% |
Image 1 | Human 293T
| Host: Rabbit Target Name: CLCN3 Sample Tissue: Human 293T Antibody Dilution: 1.0ug/ml |
|
Image 2 | Human Brain
| Human Brain |
|