Product Number |
ARP35497_P050 |
Product Page |
www.avivasysbio.com/kcnip2-antibody-n-terminal-region-arp35497-p050.html |
Name |
KCNIP2 Antibody - N-terminal region (ARP35497_P050) |
Protein Size (# AA) |
227 amino acids |
Molecular Weight |
21kDa |
NCBI Gene Id |
30819 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Kv channel interacting protein 2 |
Alias Symbols |
KCHIP2 |
Peptide Sequence |
Synthetic peptide located within the following region: QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kim,L.A., et al., (2004) J. Biol. Chem. 279 (7), 5549-5554 |
Description of Target |
KCNIP2 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium.This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. |
Protein Interactions |
KCND2; KCNIP1; KCNIP2; KCNE4; KCND3; KCNIP4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KCNIP2 (ARP35497_P050) antibody |
Blocking Peptide |
For anti-KCNIP2 (ARP35497_P050) antibody is Catalog # AAP35497 (Previous Catalog # AAPS27401) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP2 |
Uniprot ID |
Q9NS61-6 |
Protein Name |
Kv channel-interacting protein 2 |
Sample Type Confirmation |
KCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_775285 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_173193 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
KCNIP2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Mouse Liver
| Host: Mouse Target Name: KCNIP2 Sample Tissue: Mouse Liver Antibody Dilution: 1ug/ml |
|
Image 2 | Human Jurkat
| WB Suggested Anti-KCNIP2 Antibody Titration: 0.06ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysateKCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
Image 3 | Human Brain
| Human Brain |
|