KCNIP2 Antibody - N-terminal region (ARP35497_P050)

Data Sheet
 
Product Number ARP35497_P050
Product Page www.avivasysbio.com/kcnip2-antibody-n-terminal-region-arp35497-p050.html
Name KCNIP2 Antibody - N-terminal region (ARP35497_P050)
Protein Size (# AA) 227 amino acids
Molecular Weight 21kDa
NCBI Gene Id 30819
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Kv channel interacting protein 2
Alias Symbols KCHIP2
Peptide Sequence Synthetic peptide located within the following region: QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kim,L.A., et al., (2004) J. Biol. Chem. 279 (7), 5549-5554
Description of Target KCNIP2 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium.This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
Protein Interactions KCND2; KCNIP1; KCNIP2; KCNE4; KCND3; KCNIP4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCNIP2 (ARP35497_P050) antibody
Blocking Peptide For anti-KCNIP2 (ARP35497_P050) antibody is Catalog # AAP35497 (Previous Catalog # AAPS27401)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP2
Uniprot ID Q9NS61-6
Protein Name Kv channel-interacting protein 2
Sample Type Confirmation

KCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_775285
Purification Affinity Purified
Nucleotide Accession # NM_173193
Tested Species Reactivity Human, Mouse
Gene Symbol KCNIP2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Mouse Liver
Host: Mouse
Target Name: KCNIP2
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml
Image 2
Human Jurkat
WB Suggested Anti-KCNIP2 Antibody Titration: 0.06ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateKCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 3
Human Brain
Human Brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com