Product Number |
ARP35490_P050 |
Product Page |
www.avivasysbio.com/kcnip2-antibody-middle-region-arp35490-p050.html |
Name |
KCNIP2 Antibody - middle region (ARP35490_P050) |
Protein Size (# AA) |
270 amino acids |
Molecular Weight |
31kDa |
NCBI Gene Id |
30819 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Kv channel interacting protein 2 |
Alias Symbols |
KCHIP2 |
Peptide Sequence |
Synthetic peptide located within the following region: LQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Han,W., (2006) J. Biol. Chem. 281 (37), 27134-27144 |
Description of Target |
The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. |
Protein Interactions |
KCND2; KCNIP1; KCNIP2; KCNE4; KCND3; KCNIP4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KCNIP2 (ARP35490_P050) antibody |
Blocking Peptide |
For anti-KCNIP2 (ARP35490_P050) antibody is Catalog # AAP35490 (Previous Catalog # AAPP07285) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human KCNIP2 |
Uniprot ID |
Q9NS61 |
Protein Name |
Kv channel-interacting protein 2 |
Protein Accession # |
NP_775283 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_173191 |
Tested Species Reactivity |
Human |
Gene Symbol |
KCNIP2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human Stomach
| WB Suggested Anti-KCNIP2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Stomach |
|