| Product Number |
ARP35484_P050 |
| Product Page |
www.avivasysbio.com/kcnh7-antibody-n-terminal-region-arp35484-p050.html |
| Name |
KCNH7 Antibody - N-terminal region (ARP35484_P050) |
| Protein Size (# AA) |
732 amino acids |
| Molecular Weight |
83kDa |
| NCBI Gene Id |
90134 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Potassium voltage-gated channel, subfamily H (eag-related), member 7 |
| Alias Symbols |
ERG3, HERG3, Kv11.3 |
| Peptide Sequence |
Synthetic peptide located within the following region: PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Martinez,A., (er) Eur. J. Hum. Genet. (2008) In press |
| Description of Target |
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH7 is a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. There are at least two alternatively spliced transcript variants derived from this gene and encoding distinct isoforms. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KCNH7 (ARP35484_P050) antibody |
| Blocking Peptide |
For anti-KCNH7 (ARP35484_P050) antibody is Catalog # AAP35484 (Previous Catalog # AAPP06724) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNH7 |
| Uniprot ID |
Q8IV15 |
| Protein Name |
Potassium voltage-gated channel subfamily H member 7 |
| Protein Accession # |
NP_775185 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_173162 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KCNH7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human 721_B
 | WB Suggested Anti-KCNH7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate |
|
|
