KCNH6 Antibody - middle region (ARP35480_P050)

Data Sheet
 
Product Number ARP35480_P050
Product Page www.avivasysbio.com/kcnh6-antibody-middle-region-arp35480-p050.html
Name KCNH6 Antibody - middle region (ARP35480_P050)
Protein Size (# AA) 994 amino acids
Molecular Weight 109kDa
NCBI Gene Id 81033
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Potassium voltage-gated channel, subfamily H (eag-related), member 6
Alias Symbols ERG2, ERG-2, HERG2, Kv11.2, hERG-2
Peptide Sequence Synthetic peptide located within the following region: LSTLYFISRGSIEILRDDVVVAILGKNDIFGEPVSLHAQPGKSSADVRAL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bauer,C.K., et al., (2003) Pflugers Arch. 445 (5), 589-600
Description of Target Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCNH6 (ARP35480_P050) antibody
Blocking Peptide For anti-KCNH6 (ARP35480_P050) antibody is Catalog # AAP35480 (Previous Catalog # AAPP06720)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KCNH6
Uniprot ID Q9H252
Protein Name Potassium voltage-gated channel subfamily H member 6
Protein Accession # NP_110406
Purification Affinity Purified
Nucleotide Accession # NM_030779
Tested Species Reactivity Human
Gene Symbol KCNH6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%; Zebrafish: 79%
Image 1
Human HepG2
WB Suggested Anti-KCNH6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com