KCNH5 Antibody - N-terminal region (ARP35478_P050)

• Product Number: ARP35478_P050
• Name: KCNH5 Antibody - N-terminal region (ARP35478_P050)
• Protein Size (# AA): 988 amino acids
• Molecular Weight: 112 kDa
• NCBI Gene Id: 27133
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Potassium voltage-gated channel, subfamily H (eag-related), member 5
• Alias Symbols: EAG2, hEAG2, H-EAG2, Kv10.2
• Peptide Sequence: Synthetic peptide located within the following region: LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ju,M. et al., (2002) FEBS Lett. 524 (1-3), 204-210
• Description of Target: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNH5 gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. KCNH5 is not expressed in differentiating myoblasts.
• Protein Interactions: KCNH1; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-KCNH5 (ARP35478_P050) antibody is Catalog # AAP35478 (Previous Catalog # AAPP06718)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNH5
• Uniprot ID: Q8NCM2-2
• Protein Name: Potassium voltage-gated channel subfamily H member 5
• Protein Accession #: NP_758963
• Purification: Affinity Purified
• Nucleotide Accession #: NM_172375
• Tested Species Reactivity: Human
• Gene Symbol: KCNH5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-KCNH5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate
• Image 2: Human Brain
  
  Human Brain
• Image 3: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recognizes isoform 2 at ~70 kDa in these samples which do not appear to express isoform 1 at 112 kDa.