KCNQ2 Antibody - middle region (ARP35459_T100)

Data Sheet
 
Product Number ARP35459_T100
Product Page www.avivasysbio.com/kcnq2-antibody-middle-region-arp35459-t100.html
Name KCNQ2 Antibody - middle region (ARP35459_T100)
Protein Size (# AA) 393 amino acids
Molecular Weight 43kDa
NCBI Gene Id 3785
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Potassium voltage-gated channel, KQT-like subfamily, member 2
Description
Alias Symbols EBN, BFNC, DEE7, EBN1, ENB1, HNSPC, KV7.2, KCNA11
Peptide Sequence Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tang,B., et al., (2004) J. Neurol. Sci. 221 (1-2), 31-34
Description of Target The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).
Protein Interactions ARIH2; KCNQ3; PRKCA; CALM3; CALM1; CALM2; KCNQ1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCNQ2 (ARP35459_T100) antibody
Blocking Peptide For anti-KCNQ2 (ARP35459_T100) antibody is Catalog # AAP35459 (Previous Catalog # AAPP07278)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KCNQ2
Uniprot ID Q5VYU0
Publications

Functional responses of the hippocampus to hyperexcitability depend on directed, neuron-specific KCNQ2 K+ channel plasticity. Hippocampus. 30, 435-455 (2020) 31621989

Zhang, H. et al. Membrane microdomain determines the specificity of receptor-mediated modulation of Kv7/M potassium currents. Neuroscience 254, 70-9 (2013). 24036375

Protein Accession # NP_742107
Purification Protein A purified
Nucleotide Accession # NM_172109
Tested Species Reactivity Human, Mouse
Gene Symbol KCNQ2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Image 1
Mouse Skeletal Muscle
Host: Mouse
Target Name: KCNQ2
Sample Tissue: Mouse Skeletal Muscle
Antibody Dilution: 1ug/ml
Image 2
Human HepG2
WB Suggested Anti-KCNQ2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Image 3
Human kidney
Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com