Product Number |
ARP35452_T100 |
Product Page |
www.avivasysbio.com/catsper2-antibody-c-terminal-region-arp35452-t100.html |
Name |
CATSPER2 Antibody - C-terminal region (ARP35452_T100) |
Protein Size (# AA) |
528 amino acids |
Molecular Weight |
58kDa |
NCBI Gene Id |
117155 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cation channel, sperm associated 2 |
Peptide Sequence |
Synthetic peptide located within the following region: LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Quill,T.A., et al., (2001) Proc. Natl. Acad. Sci. U.S.A. 98 (22), 12527-12531 |
Description of Target |
Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandem repeat on chromosome 15q14; the second copy of this gene is thought to be a pseudogene. Additional splice variants have been described but their full-length nature has not been determined. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CATSPER2 (ARP35452_T100) antibody |
Blocking Peptide |
For anti-CATSPER2 (ARP35452_T100) antibody is Catalog # AAP35452 (Previous Catalog # AAPP06689) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CATSPER2 |
Uniprot ID |
Q96P56 |
Protein Name |
Cation channel sperm-associated protein 2 |
Protein Accession # |
NP_473361 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_054020 |
Tested Species Reactivity |
Human |
Gene Symbol |
CATSPER2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 86%; Yeast: 79% |
Image 1 | Human HepG2
| WB Suggested Anti-CATSPER2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|
|