| Product Number |
ARP35437_P050 |
| Product Page |
www.avivasysbio.com/p2rx2-antibody-middle-region-arp35437-p050.html |
| Name |
P2rx2 Antibody - middle region (ARP35437_P050) |
| Protein Size (# AA) |
395 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
231602 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Purinergic receptor P2X, ligand-gated ion channel, 2 |
| Alias Symbols |
P2x, P2x2, P2X2a |
| Peptide Sequence |
Synthetic peptide located within the following region: EHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-P2rx2 (ARP35437_P050) antibody |
| Blocking Peptide |
For anti-P2rx2 (ARP35437_P050) antibody is Catalog # AAP35437 (Previous Catalog # AAPP06675) |
| Uniprot ID |
Q812E7 |
| Protein Name |
P2X purinoceptor RuleBase RU000681 |
| Protein Accession # |
NP_001158306 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001164834 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
P2rx2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Small Intestine
 | WB Suggested Anti-P2rx2 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Small Intestine |
|
|
