CHRNA7 Antibody - middle region (ARP35418_T100)

Data Sheet
 
Product Number ARP35418_T100
Product Page www.avivasysbio.com/chrna7-antibody-middle-region-arp35418-t100.html
Name CHRNA7 Antibody - middle region (ARP35418_T100)
Protein Size (# AA) 502 amino acids
Molecular Weight 56kDa
Subunit alpha-7
NCBI Gene Id 1139
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cholinergic receptor, nicotinic, alpha 7 (neuronal)
Alias Symbols NACHRA7, CHRNA7-2
Peptide Sequence Synthetic peptide located within the following region: VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Avramopoulou,V., et al., (2004) J. Biol. Chem. 279 (37), 38287-38293
Description of Target The protein encoded by CHRNA7 displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia.
Protein Interactions ATXN1; ADCY6; PIK3R1; APP; FYN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CHRNA7 (ARP35418_T100) antibody
Blocking Peptide For anti-CHRNA7 (ARP35418_T100) antibody is Catalog # AAP35418 (Previous Catalog # AAPP06656)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CHRNA7
Uniprot ID P36544
Protein Name Neuronal acetylcholine receptor subunit alpha-7
Sample Type Confirmation

CHRNA7 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_000737
Purification Protein A purified
Nucleotide Accession # NM_000746
Tested Species Reactivity Human
Gene Symbol CHRNA7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-CHRNA7 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateCHRNA7 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com