Product Number |
ARP35418_T100 |
Product Page |
www.avivasysbio.com/chrna7-antibody-middle-region-arp35418-t100.html |
Name |
CHRNA7 Antibody - middle region (ARP35418_T100) |
Protein Size (# AA) |
502 amino acids |
Molecular Weight |
56kDa |
Subunit |
alpha-7 |
NCBI Gene Id |
1139 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cholinergic receptor, nicotinic, alpha 7 (neuronal) |
Alias Symbols |
NACHRA7, CHRNA7-2 |
Peptide Sequence |
Synthetic peptide located within the following region: VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Avramopoulou,V., et al., (2004) J. Biol. Chem. 279 (37), 38287-38293 |
Description of Target |
The protein encoded by CHRNA7 displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. |
Protein Interactions |
ATXN1; ADCY6; PIK3R1; APP; FYN; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CHRNA7 (ARP35418_T100) antibody |
Blocking Peptide |
For anti-CHRNA7 (ARP35418_T100) antibody is Catalog # AAP35418 (Previous Catalog # AAPP06656) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CHRNA7 |
Uniprot ID |
P36544 |
Protein Name |
Neuronal acetylcholine receptor subunit alpha-7 |
Sample Type Confirmation |
CHRNA7 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_000737 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000746 |
Tested Species Reactivity |
Human |
Gene Symbol |
CHRNA7 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-CHRNA7 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysateCHRNA7 is supported by BioGPS gene expression data to be expressed in Jurkat |
|