Product Number |
ARP35414_T100 |
Product Page |
www.avivasysbio.com/cacng6-antibody-n-terminal-region-arp35414-t100.html |
Name |
CACNG6 Antibody - N-terminal region (ARP35414_T100) |
Protein Size (# AA) |
214 amino acids |
Molecular Weight |
24kDa |
NCBI Gene Id |
59285 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Calcium channel, voltage-dependent, gamma subunit 6 |
Peptide Sequence |
Synthetic peptide located within the following region: RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Chu,P.J., et al., (2001) Gene 280 (1-2), 37-48 |
Description of Target |
L-type calcium channels are composed of five subunits. The protein encoded by CACNG6 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. CACNG6 is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CACNG6 (ARP35414_T100) antibody |
Blocking Peptide |
For anti-CACNG6 (ARP35414_T100) antibody is Catalog # AAP35414 (Previous Catalog # AAPP06652) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CACNG6 |
Uniprot ID |
Q9BXT2 |
Protein Name |
Voltage-dependent calcium channel gamma-6 subunit |
Protein Accession # |
NP_665814 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_145815 |
Tested Species Reactivity |
Human |
Gene Symbol |
CACNG6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 82%; Dog: 91%; Guinea Pig: 83%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92% |
Image 1 | Human HepG2
| WB Suggested Anti-CACNG6 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
|