Product Number |
ARP35409_P050 |
Product Page |
www.avivasysbio.com/chrfam7a-antibody-n-terminal-region-arp35409-p050.html |
Name |
CHRFAM7A Antibody - N-terminal region (ARP35409_P050) |
Protein Size (# AA) |
412 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
89832 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion |
Alias Symbols |
D-10, CHRNA7, NACHRA7, CHRNA7-DR1 |
Peptide Sequence |
Synthetic peptide located within the following region: QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Trombino,S., et al., (2004) Cancer Res. 64 (1), 135-145 |
Description of Target |
The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7 is located on chromosome 15 in a region associated with several neuropsychiatric disorders. CHRFAM7A is is a hybrid between CHRNA7 and FAM7A. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CHRFAM7A (ARP35409_P050) antibody |
Blocking Peptide |
For anti-CHRFAM7A (ARP35409_P050) antibody is Catalog # AAP35409 (Previous Catalog # AAPP06647) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRFAM7A |
Uniprot ID |
Q494W8 |
Protein Name |
CHRNA7-FAM7A fusion protein |
Sample Type Confirmation |
CHRFAM7A is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_647536 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_139320 |
Tested Species Reactivity |
Human |
Gene Symbol |
CHRFAM7A |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human MCF7
| Host: Rabbit Target Name: CHRFAM7A Sample Tissue: Human MCF7 Antibody Dilution: 1.0ug/ml |
|