CHRFAM7A Antibody - N-terminal region (ARP35409_P050)

Data Sheet
 
Product Number ARP35409_P050
Product Page www.avivasysbio.com/chrfam7a-antibody-n-terminal-region-arp35409-p050.html
Name CHRFAM7A Antibody - N-terminal region (ARP35409_P050)
Protein Size (# AA) 412 amino acids
Molecular Weight 45kDa
NCBI Gene Id 89832
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion
Alias Symbols D-10, CHRNA7, NACHRA7, CHRNA7-DR1
Peptide Sequence Synthetic peptide located within the following region: QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Trombino,S., et al., (2004) Cancer Res. 64 (1), 135-145
Description of Target The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7 is located on chromosome 15 in a region associated with several neuropsychiatric disorders. CHRFAM7A is is a hybrid between CHRNA7 and FAM7A.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CHRFAM7A (ARP35409_P050) antibody
Blocking Peptide For anti-CHRFAM7A (ARP35409_P050) antibody is Catalog # AAP35409 (Previous Catalog # AAPP06647)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CHRFAM7A
Uniprot ID Q494W8
Protein Name CHRNA7-FAM7A fusion protein
Sample Type Confirmation

CHRFAM7A is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_647536
Purification Affinity Purified
Nucleotide Accession # NM_139320
Tested Species Reactivity Human
Gene Symbol CHRFAM7A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human MCF7
Host: Rabbit
Target Name: CHRFAM7A
Sample Tissue: Human MCF7
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com