CLIC6 Antibody - middle region (ARP35388_P050)

• Product Number: ARP35388_P050
• Name: CLIC6 Antibody - middle region (ARP35388_P050)
• Protein Size (# AA): 686 amino acids
• Molecular Weight: 75kDa
• NCBI Gene Id: 54102
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chloride intracellular channel 6
• Alias Symbols: CLIC1L
• Peptide Sequence: Synthetic peptide located within the following region: RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Friedli,M., et al., (2003) Gene 320, 31-40
• Description of Target: CLIon Channel6 encodes a member of the chloride intracellular channel family of proteins. The gene is part of a large triplicated region found on chromosomes 1, 6, and 21.
• Protein Interactions: DRD3; DRD2; DRD4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CLIC6 (ARP35388_P050) antibody is Catalog # AAP35388 (Previous Catalog # AAPP06626)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CLIC6
• Uniprot ID: Q96NY7-2
• Protein Name: Chloride intracellular channel protein 6
• Protein Accession #: NP_444507
• Purification: Affinity Purified
• Nucleotide Accession #: NM_053277
• Tested Species Reactivity: Human
• Gene Symbol: CLIC6
• Predicted Species Reactivity: Human, Mouse, Rat, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-CLIC6 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:2500
  Positive Control: Jurkat cell lysate