KCTD10 Antibody - N-terminal region (ARP35370_T100)

Data Sheet
 
Product Number ARP35370_T100
Product Page www.avivasysbio.com/kctd10-antibody-n-terminal-region-arp35370-t100.html
Name KCTD10 Antibody - N-terminal region (ARP35370_T100)
Protein Size (# AA) 313 amino acids
Molecular Weight 34kDa
NCBI Gene Id 83892
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Potassium channel tetramerisation domain containing 10
Alias Symbols BTBD28, ULRO61, MSTP028, hBACURD3
Peptide Sequence Synthetic peptide located within the following region: MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Description of Target KCTD10, a rat potassium channel tetramerisation domain-containing 10 gene is a novel member of the polymerase delta-interacting protein 1 (PDIP1) gene family. KCTD10 shares significant similarity in amino acid sequence to PDIP1 and can interact with the small subunit of DNA polymerase delta and PCNA as PDIP1 does. Like PDIP1, the expression of KCTD10 gene can be induced by TNF-alpha in NIH3T3 cells.
Protein Interactions UBC; RNF2; FMNL1; CUL3; PCNA; DCUN1D1; COPS5; COPS6; NEDD8; TNFAIP1; SH3KBP1; ITSN2; Cd2ap; KCTD13; USP25; USP13; ATXN3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCTD10 (ARP35370_T100) antibody
Blocking Peptide For anti-KCTD10 (ARP35370_T100) antibody is Catalog # AAP35370 (Previous Catalog # AAPP06608)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD10
Uniprot ID Q9H3F6
Protein Name BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3
Protein Accession # NP_114160
Purification Protein A purified
Nucleotide Accession # NM_031954
Tested Species Reactivity Human
Gene Symbol KCTD10
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%
Image 1
Human Jurkat
WB Suggested Anti-KCTD10 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com