KCNA7 Antibody - C-terminal region (ARP35365_P050)

• Product Number: ARP35365_P050
• Name: KCNA7 Antibody - C-terminal region (ARP35365_P050)
• Protein Size (# AA): 456 amino acids
• Molecular Weight: 50kDa
• NCBI Gene Id: 3743
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Potassium voltage-gated channel, shaker-related subfamily, member 7
• Alias Symbols: HAK6, KV1.7
• Peptide Sequence: Synthetic peptide located within the following region: GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hillier,L.D., et al., (2002) Eur. J. Hum. Genet. 10 (1), 36-43
• Description of Target: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, e
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KCNA7 (ARP35365_P050) antibody is Catalog # AAP35365 (Previous Catalog # AAPP06603)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KCNA7
• Uniprot ID: Q96RP8
• Protein Name: Potassium voltage-gated channel subfamily A member 7
• Protein Accession #: NP_114092
• Purification: Affinity Purified
• Nucleotide Accession #: NM_031886
• Tested Species Reactivity: Human
• Gene Symbol: KCNA7
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-KCNA7 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysate