KCNH6 Antibody - N-terminal region (ARP35363_T100)

Data Sheet
 
Product Number ARP35363_T100
Product Page www.avivasysbio.com/kcnh6-antibody-n-terminal-region-arp35363-t100.html
Name KCNH6 Antibody - N-terminal region (ARP35363_T100)
Protein Size (# AA) 994 amino acids
Molecular Weight 109kDa
NCBI Gene Id 81033
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Potassium voltage-gated channel, subfamily H (eag-related), member 6
Alias Symbols ERG2, ERG-2, HERG2, Kv11.2, hERG-2
Peptide Sequence Synthetic peptide located within the following region: GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bauer,C.K., et al., (2003) Arch. 445 (5), 589-600
Description of Target Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH6 encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCNH6 (ARP35363_T100) antibody
Blocking Peptide For anti-KCNH6 (ARP35363_T100) antibody is Catalog # AAP35363 (Previous Catalog # AAPP06601)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KCNH6
Uniprot ID Q9H252-3
Protein Name Potassium voltage-gated channel subfamily H member 6
Protein Accession # NP_110406
Purification Protein A purified
Nucleotide Accession # NM_030779
Tested Species Reactivity Human
Gene Symbol KCNH6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-KCNH6 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Image 2
Human Brain
Human Brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com