Product Number |
ARP35342_P050 |
Product Page |
www.avivasysbio.com/gabre-antibody-middle-region-arp35342-p050.html |
Name |
GABRE Antibody - middle region (ARP35342_P050) |
Protein Size (# AA) |
393 amino acids |
Molecular Weight |
43kDa |
Subunit |
epsilon |
NCBI Gene Id |
2564 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, epsilon |
Peptide Sequence |
Synthetic peptide located within the following region: KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sinkkonen,S.T., et al., (2000) J. Neurosci. 20 (10), 3588-3595 |
Description of Target |
GABRE belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GABRE (ARP35342_P050) antibody |
Blocking Peptide |
For anti-GABRE (ARP35342_P050) antibody is Catalog # AAP35342 (Previous Catalog # AAPP06577) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GABRE |
Uniprot ID |
P78334 |
Publications |
Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. Expression of GABAA a2-, beta1- and e-receptors are altered significantly in the lateral cerebellum of subjects with schizophrenia, major depression and bipolar disorder. Transl. Psychiatry 3, e303 (2013). 24022508
Hengen, K. B. et al. Increased GABA(A) receptor e-subunit expression on ventral respiratory column neurons protects breathing during pregnancy. PLoS One 7, e30608 (2012). 22303446
Hengen, K. B., Gomez, T. M., Stang, K. M., Johnson, S. M. & Behan, M. Changes in ventral respiratory column GABAaR e- and d-subunits during hibernation mediate resistance to depression by EtOH and pentobarbital. Am. J. Physiol. Regul. Integr. Comp. Physiol. 300, R272-83 (2011). 21084677 |
Protein Accession # |
NP_068819 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_021984 |
Tested Species Reactivity |
Human |
Gene Symbol |
GABRE |
Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 79%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 92% |
Image 1 | Human Placenta
| WB Suggested Anti-GABRE Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta |
|
Image 2 | Human 786-0 Whole Cell
| Host: Rabbit Target Name: GABRE Sample Tissue: Human 786-0 Whole Cell Antibody Dilution: 3ug/ml |
|