Product Number |
ARP35325_T100 |
Product Page |
www.avivasysbio.com/kcnk10-antibody-c-terminal-region-arp35325-t100.html |
Name |
KCNK10 Antibody - C-terminal region (ARP35325_T100) |
Protein Size (# AA) |
538 amino acids |
Molecular Weight |
59kDa |
NCBI Gene Id |
54207 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Potassium channel, subfamily K, member 10 |
Alias Symbols |
TREK2, TREK-2, K2p10.1, PPP1R97 |
Peptide Sequence |
Synthetic peptide located within the following region: EDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELEN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Gu,W., et al., (2002) J. Physiol. (Lond.) 539 (PT 3), 657-668 |
Description of Target |
KCNK10 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is highly expressed in the kidney and pancreas. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. The protein is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Three transcript variants have been identified for this gene. |
Protein Interactions |
PPP1CA; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KCNK10 (ARP35325_T100) antibody |
Blocking Peptide |
For anti-KCNK10 (ARP35325_T100) antibody is Catalog # AAP35325 (Previous Catalog # AAPP06561) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK10 |
Uniprot ID |
P57789 |
Protein Name |
Potassium channel subfamily K member 10 |
Protein Accession # |
NP_066984 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_021161 |
Tested Species Reactivity |
Human |
Gene Symbol |
KCNK10 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-KCNK10 Antibody Titration: 2.5ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|