MCOLN1 Antibody - N-terminal region (ARP35307_P050)

• Product Number: ARP35307_P050
• Name: MCOLN1 Antibody - N-terminal region (ARP35307_P050)
• Protein Size (# AA): 580 amino acids
• Molecular Weight: 64 kDa
• NCBI Gene Id: 57192
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mucolipin 1
• Alias Symbols: ML1, ML4, MG-2, MLIV, MST080, TRPML1, MSTP080, TRP-ML1, TRPM-L1
• Peptide Sequence: Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: LaPlante,J.M., et al., (2004) Biochem. Biophys. Res. Commun. 322 (4), 1384-1391
• Description of Target: MCOLN1 encodes a protein that may be involved in calcium signaling and membrane trafficking in mucolipidosis IV.
• Protein Interactions: TRIM27; SLC35E1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-MCOLN1 (ARP35307_P050) antibody is Catalog # AAP35307 (Previous Catalog # AAPP06544)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MCOLN1
• Uniprot ID: Q9GZU1
• Protein Name: Mucolipin-1
• Protein Accession #: NP_065394
• Purification: Affinity Purified
• Nucleotide Accession #: NM_020533
• Tested Species Reactivity: Human
• Gene Symbol: MCOLN1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
• Image 1: Human Fetal Lung
  
  Host: Rabbit
  Target Name: MCOLN1
  Sample Tissue: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 2: Human Placenta, Human liver
  
  Host: Rabbit
  Target: MCOLN1
  Positive control (+): Human Placenta (PL)
  Negative control (-): Human liver (LI)
  Antibody concentration: 1ug/ml
• Image 3: Human THP-1 Whole Cell
  
  Host: Rabbit
  Target Name: MCOLN1
  Sample Tissue: Human THP-1 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 4: Human 786-0 Whole Cell
  
  Host: Rabbit
  Target Name: MCOLN1
  Sample Tissue: Human 786-0 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 5: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. MCOLN1 can be glycosylated among other modifications.