NMUR2 Antibody - N-terminal region (ARP35300_T100)

Data Sheet
 
Product Number ARP35300_T100
Product Page www.avivasysbio.com/nmur2-antibody-n-terminal-region-arp35300-t100.html
Name NMUR2 Antibody - N-terminal region (ARP35300_T100)
Protein Size (# AA) 415 amino acids
Molecular Weight 46kDa
NCBI Gene Id 56923
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Neuromedin U receptor 2
Alias Symbols FM4, FM-4, TGR1, NMU2R, TGR-1, NMU-R2
Peptide Sequence Synthetic peptide located within the following region: MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Fernandez (2002) Peptides 23 (9), 1617-1623
Description of Target NMUR2 encodes for one of two G-protein-coupled receptors for the neuropeptide, neuromedin U. This peptide is found in highest levels in the gut and genitourinary system where it potently contracts smooth muscle but is also expressed in the spinal cord and discrete regions of the brain. NMUR2 is highly expressed in the central nervous system.
Protein Interactions NOTCH2NL; KRTAP13-1; ADAMTSL4; TRAF2; TCF4; NMU; NMS;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NMUR2 (ARP35300_T100) antibody
Blocking Peptide For anti-NMUR2 (ARP35300_T100) antibody is Catalog # AAP35300
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NMUR2
Uniprot ID Q9GZQ4
Protein Name Neuromedin-U receptor 2
Protein Accession # NP_064552
Purification Protein A purified
Nucleotide Accession # NM_020167
Tested Species Reactivity Human
Gene Symbol NMUR2
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HepG2
WB Suggested Anti-NMUR2 Antibody
Titration: 2.5 ug/ml
Positive Control: HepG2 Whole Cell
Image 2
Mouse Testis, Mouse Heart
Host: Rabbit
Target: NMUR2
Positive control (+): Mouse Testis (M-TE)
Negative control (-): Mouse Heart (M-HE)
Antibody concentration: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com