Product Number |
ARP35300_P050 |
Product Page |
www.avivasysbio.com/nmur2-antibody-n-terminal-region-arp35300-p050.html |
Name |
NMUR2 Antibody - N-terminal region (ARP35300_P050) |
Protein Size (# AA) |
415 amino acids |
Molecular Weight |
46kDa |
NCBI Gene Id |
56923 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Neuromedin U receptor 2 |
Alias Symbols |
FM4, FM-4, TGR1, NMU2R, TGR-1, NMU-R2 |
Peptide Sequence |
Synthetic peptide located within the following region: MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Fernandez,Alvarez C., et al., (2002) Peptides. 23(9), 1617-23 |
Description of Target |
NMUR2 encodes for one of two G-protein-coupled receptors for the neuropeptide, neuromedin U. This peptide is found in highest levels in the gut and genitourinary system where it potently contracts smooth muscle but is also expressed in the spinal cord and discrete regions of the brain. NMUR2 is highly expressed in the central nervous system. |
Protein Interactions |
NOTCH2NL; KRTAP13-1; ADAMTSL4; TRAF2; TCF4; NMU; NMS; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NMUR2 (ARP35300_P050) antibody |
Blocking Peptide |
For anti-NMUR2 (ARP35300_P050) antibody is Catalog # AAP35300 (Previous Catalog # AAPP06538) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NMUR2 |
Uniprot ID |
Q9GZQ4 |
Protein Name |
Neuromedin-U receptor 2 |
Protein Accession # |
NP_064552 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_020167 |
Tested Species Reactivity |
Human |
Gene Symbol |
NMUR2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Mouse Testis, Mouse Heart
| Host: Rabbit Target: NMUR2 Positive control (+): Mouse Testis (M-TE) Negative control (-): Mouse Heart (M-HE) Antibody concentration: 1ug/ml |
| Image 2 | Human HepG2
| WB Suggested Anti-NMUR2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|
|