Product Number |
ARP35263_T100 |
Product Page |
www.avivasysbio.com/clic5-antibody-c-terminal-region-arp35263-t100.html |
Name |
CLIC5 Antibody - C-terminal region (ARP35263_T100) |
Protein Size (# AA) |
251 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
53405 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Chloride intracellular channel 5 |
Alias Symbols |
MST130, DFNB102, DFNB103, MSTP130 |
Peptide Sequence |
Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Otsuki,T., (2005) DNA Res. 12 (2), 117-126 |
Description of Target |
Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.[supplied by OMIM]. |
Protein Interactions |
SRPK1; FN1; IQGAP1; GSN; EZR; ACTA1; ACTN1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CLIC5 (ARP35263_T100) antibody |
Blocking Peptide |
For anti-CLIC5 (ARP35263_T100) antibody is Catalog # AAP35263 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC5 |
Uniprot ID |
Q9NZA1 |
Protein Name |
Chloride intracellular channel protein 5 |
Publications |
Both CLIC4 and CLIC5A activate ERM proteins in glomerular endothelium. Am. J. Physiol. Renal Physiol. 311, F945-F957 (2016). 27582103 |
Sample Type Confirmation |
There is BioGPS gene expression data showing that CLIC5 is expressed in Jurkat |
Protein Accession # |
NP_058625 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_016929 |
Tested Species Reactivity |
Human |
Gene Symbol |
CLIC5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Image 1 | Human Jurkat
| WB Suggested Anti-CLIC5 Antibody Titration: 1.25ug/ml Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that CLIC5 is expressed in Jurkat |
|
Image 2 | Human kidney
| Human kidney |
|